PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sme2.5_00228.1_g00012.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family NAC
Protein Properties Length: 504aa    MW: 57369.6 Da    PI: 4.5994
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sme2.5_00228.1_g00012.1genomeEGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM148.72.9e-46421672128
                      NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.kkvkaeekewyfFskrdkkyatgkrknratksgyWkat 86 
                              p G+rF P+d+el+v+yLkkk+ ++ l+  + ikev++y+++P++L  + +  +++ewyfF++rd+ky++g+r+nra+ +gyWkat
  Sme2.5_00228.1_g00012.1  42 PSGYRFCPHDQELIVYYLKKKIMNEVLPH-NKIKEVNLYRHNPEELSeNYAVLGDNEWYFFTPRDRKYPNGDRPNRAAGTGYWKAT 126
                              89************************999.77**************8445556999****************************** PP

                      NAM  87 gkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                              g dk++++ ++ +vg +k Lvf++g+ p+g+kt+W+mhe+r+
  Sme2.5_00228.1_g00012.1 127 GADKPIMH-NNITVGFRKALVFHQGKPPNGNKTNWIMHEFRV 167
                              ********.999****************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.35E-5438192IPR003441NAC domain
PROSITE profilePS5100553.53541193IPR003441NAC domain
PfamPF023654.0E-2442167IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 504 aa     Download sequence    Send to blast
MESYEENKAL MKANCWNTSV NPKMHKQKKR KLQIHDDNFV FPSGYRFCPH DQELIVYYLK  60
KKIMNEVLPH NKIKEVNLYR HNPEELSENY AVLGDNEWYF FTPRDRKYPN GDRPNRAAGT  120
GYWKATGADK PIMHNNITVG FRKALVFHQG KPPNGNKTNW IMHEFRVNES PRPKADASDM  180
KLDDWVLCRI YKRYSKSKDK EEHKQKNANK NNSPLPTMVD KSEKEVFMDN SCVEFAKQQF  240
GADDLNFVFD FSKYNPDYFP YYGAEINIQS SFPPPATLLS DPRGLYEESN IQSSFSPPAT  300
SLSDPRGLYE ENNIQSSFSP PATSLSDPRG LYEESTIQSS FSPLAISLFP PYEENNVQSS  360
YSPPATLLSD PRGLYEESNI QSSFSPLATL LLDPRGLYEE SNIQSSFSPP AISLFPPYEE  420
NNVQSSFSSP ATLLFSPPAT LLSVPSELDE ESNIQLSVSP PSTDPDEFPD DSPPATDPGE  480
FPDELDEENN IFPINFYYSP ENSS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swp_D3e-524119820173NAC domain-containing protein 19
3swp_C3e-524119820173NAC domain-containing protein 19
3swp_B3e-524119820173NAC domain-containing protein 19
3swp_A3e-524119820173NAC domain-containing protein 19
3swm_D3e-524119820173NAC domain-containing protein 19
3swm_C3e-524119820173NAC domain-containing protein 19
3swm_B3e-524119820173NAC domain-containing protein 19
3swm_A3e-524119820173NAC domain-containing protein 19
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
12130PKMHKQKKRK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016546854.11e-112PREDICTED: NAC domain-containing protein 72-like
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA74624103
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G77450.15e-59NAC domain containing protein 32